PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676735754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family bZIP
Protein Properties Length: 710aa    MW: 77192.5 Da    PI: 6.4097
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676735754genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.5e-13212273162
                XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                e++ k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +  ++L  ++     e a+l+++
  676735754 212 EEDEKKKARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKITYFMAENATLRQQ 273
                678899************************************99999999999999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-16212276IPR004827Basic-leucine zipper domain
PfamPF001705.1E-11213274IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.22214274IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.8E-17216274No hitNo description
SuperFamilySSF579594.63E-12216274No hitNo description
CDDcd147044.41E-21217268No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MAEPITDELP PAPDPNPTFP LPDFDSLPIP PLDHFYHSGS DHTPIGELMS DLGFPIDTDF  60
ELTFDGTEDL YLPAENETFF IPDNAEQFGD FTPDSDKRSI LHPSPSTSGC CNRESPRDSD  120
DRCSGAERLP TPLSSQGSGN CGSDVSEATN ESSPKSGNVV VDQKVKVEEA AATASVTKRK  180
KEIEEDMSDE SRSSKYRRSG EDAEASAVTG EEEDEKKKAR LMRNRESAQL SRQRKKHYVE  240
ELEEKVRNMH STITDLNGKI TYFMAENATL RQQLGGNGMC PPHHPPPPPM GMYPPMPPMA  300
YPWMPCPPYM MKQQGSQVPL VAIPRLKPQN PLGSSKAKKS ESKKSETKTK KVASISFLGL  360
LFCLFLFGAL APIVNVNYGG ISGAFYGNYR SNYVTDQIYN QHRNRVLDAS RSGAGSGVSN  420
SNGMHCGRDS DRGPGNNISA AESTVPPGND SEPLVASLFV PRNDKLVKID GNLIINSIVA  480
SEKAVASRKA SESNERKADR VIPKDYSPAL PVPDAGRIED MAKHLYRSKA EKQKALSSGS  540
ADTLKDQIKT KAANGEMQQW FREGVAGPMF SSGMCTEVFQ FDVSSTSGAI IPASPATNVS  600
AEHSKNATDT QRRKNRRTLR GLAIPLPGSD FNFTKEHQRN SSSKEIKPAS SMVVSVLVDP  660
REGGDGDIDG MIGGPKSLSR VFVVVLVDSA KYVTYSCVLP RPGAPHLVTT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1610616QRRKNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411360.10.0hypothetical protein EUTSA_v10016317mg
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLV4MJL00.0V4MJL0_EUTSA; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein